Development and validation of safety practices, perceived risk, risk coping and stigma questionnaire among frontline healthcare workers dealing with covid-19 pandemic in Hospital Universiti Sains Malaysia

Background: Healthcare workers (HCWs) are at higher risk of contracting COVID-19 infection compared to the general population. Safety practices, perceived risk, risk coping strategies and stigma faced by HCWs are important aspects to be investigated to ensure their wellbeing. This study aims to deve...

Full description

Bibliographic Details
Main Author: How, Ooi Jun
Format: Thesis
Language:English
Published: 2023
Subjects:
Online Access:http://eprints.usm.my/62748/
Abstract Abstract here
_version_ 1855633260513591296
author How, Ooi Jun
author_facet How, Ooi Jun
author_sort How, Ooi Jun
description Background: Healthcare workers (HCWs) are at higher risk of contracting COVID-19 infection compared to the general population. Safety practices, perceived risk, risk coping strategies and stigma faced by HCWs are important aspects to be investigated to ensure their wellbeing. This study aims to develop and validate Safety Practices, Perceived Risk, Risk Coping and Stigma Questionnaire among HCWs in Hospital Universiti Sains Malaysia (Hospital USM), Malaysia. Methods: The questionnaire was generated after an extensive literature review. Content validity was done by six experts, followed by face validity with eight HCWs from the Emergency Department, Hospital USM. A cross-sectional study was done among 213 frontline HCWs directly or indirectly involved in managing COVID-19 patients in Hospital USM. Exploratory factor analysis (EFA) and reliability analysis were done. Findings: Content validity was acceptable with item-level content validity index (I-CVI) ranging from 0.83 to 1.00 and scale-level content validity index (S-CVI) ranging from 0.85 to 1.00. Face validity was acceptable with item-level face validity index (I-FVI) ranging from 0.88 to 1.00 and scale-level face validity index (S-FVI) ranging from 0.85 to 1.00. For EFA, all factor loadings were more than 0.30. The safety practices domain was divided into three subdomains. The perceived risk domain showed three factors, the risk coping domain showed four factors, while the stigma domain revealed two factors. Cronbach’s alpha was acceptable (0.714-0.970) except for the factor dietary change under the risk coping domain which scored 0.479. Conclusions: The Safety Practices, Perceived Risk, Risk Coping and Stigma Questionnaire is valid. All domains of this questionnaire have good reliability, except for the factor dietary change under the risk coping domain. This validated questionnaire will thoroughly assess HCWs during the COVID-19 pandemic and guide policymakers to plan appropriate interventions if required.
first_indexed 2025-10-17T08:54:17Z
format Thesis
id usm-62748
institution Universiti Sains Malaysia
language English
last_indexed 2025-10-17T08:54:17Z
publishDate 2023
record_format EPrints
record_pdf Restricted
spelling usm-627482025-09-02T08:05:22Z http://eprints.usm.my/62748/ Development and validation of safety practices, perceived risk, risk coping and stigma questionnaire among frontline healthcare workers dealing with covid-19 pandemic in Hospital Universiti Sains Malaysia How, Ooi Jun R Medicine RA643-645 Disease (Communicable and noninfectious) and public health Background: Healthcare workers (HCWs) are at higher risk of contracting COVID-19 infection compared to the general population. Safety practices, perceived risk, risk coping strategies and stigma faced by HCWs are important aspects to be investigated to ensure their wellbeing. This study aims to develop and validate Safety Practices, Perceived Risk, Risk Coping and Stigma Questionnaire among HCWs in Hospital Universiti Sains Malaysia (Hospital USM), Malaysia. Methods: The questionnaire was generated after an extensive literature review. Content validity was done by six experts, followed by face validity with eight HCWs from the Emergency Department, Hospital USM. A cross-sectional study was done among 213 frontline HCWs directly or indirectly involved in managing COVID-19 patients in Hospital USM. Exploratory factor analysis (EFA) and reliability analysis were done. Findings: Content validity was acceptable with item-level content validity index (I-CVI) ranging from 0.83 to 1.00 and scale-level content validity index (S-CVI) ranging from 0.85 to 1.00. Face validity was acceptable with item-level face validity index (I-FVI) ranging from 0.88 to 1.00 and scale-level face validity index (S-FVI) ranging from 0.85 to 1.00. For EFA, all factor loadings were more than 0.30. The safety practices domain was divided into three subdomains. The perceived risk domain showed three factors, the risk coping domain showed four factors, while the stigma domain revealed two factors. Cronbach’s alpha was acceptable (0.714-0.970) except for the factor dietary change under the risk coping domain which scored 0.479. Conclusions: The Safety Practices, Perceived Risk, Risk Coping and Stigma Questionnaire is valid. All domains of this questionnaire have good reliability, except for the factor dietary change under the risk coping domain. This validated questionnaire will thoroughly assess HCWs during the COVID-19 pandemic and guide policymakers to plan appropriate interventions if required. 2023 Thesis NonPeerReviewed application/pdf en http://eprints.usm.my/62748/1/Ooi%20Jun%20How%20-%20E.pdf How, Ooi Jun (2023) Development and validation of safety practices, perceived risk, risk coping and stigma questionnaire among frontline healthcare workers dealing with covid-19 pandemic in Hospital Universiti Sains Malaysia. Masters thesis, Universiti Sains Malaysia.
spellingShingle R Medicine
RA643-645 Disease (Communicable and noninfectious) and public health
How, Ooi Jun
Development and validation of safety practices, perceived risk, risk coping and stigma questionnaire among frontline healthcare workers dealing with covid-19 pandemic in Hospital Universiti Sains Malaysia
thesis_level Master
title Development and validation of safety practices, perceived risk, risk coping and stigma questionnaire among frontline healthcare workers dealing with covid-19 pandemic in Hospital Universiti Sains Malaysia
title_full Development and validation of safety practices, perceived risk, risk coping and stigma questionnaire among frontline healthcare workers dealing with covid-19 pandemic in Hospital Universiti Sains Malaysia
title_fullStr Development and validation of safety practices, perceived risk, risk coping and stigma questionnaire among frontline healthcare workers dealing with covid-19 pandemic in Hospital Universiti Sains Malaysia
title_full_unstemmed Development and validation of safety practices, perceived risk, risk coping and stigma questionnaire among frontline healthcare workers dealing with covid-19 pandemic in Hospital Universiti Sains Malaysia
title_short Development and validation of safety practices, perceived risk, risk coping and stigma questionnaire among frontline healthcare workers dealing with covid-19 pandemic in Hospital Universiti Sains Malaysia
title_sort development and validation of safety practices perceived risk risk coping and stigma questionnaire among frontline healthcare workers dealing with covid 19 pandemic in hospital universiti sains malaysia
topic R Medicine
RA643-645 Disease (Communicable and noninfectious) and public health
url http://eprints.usm.my/62748/
work_keys_str_mv AT howooijun developmentandvalidationofsafetypracticesperceivedriskriskcopingandstigmaquestionnaireamongfrontlinehealthcareworkersdealingwithcovid19pandemicinhospitaluniversitisainsmalaysia